PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007976
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Dof
Protein Properties Length: 253aa    MW: 26647 Da    PI: 6.6599
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007976genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.35.3e-361568962
       zf-Dof  9 prCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                  rCds+ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rknk+s+
  Lus10007976 15 GRCDSSNTKFCYYNNYNLSQPRHFCKGCRRYWTKGGVLRNVPVGGGCRKNKRSK 68
                 59*************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS50884271266IPR003851Zinc finger, Dof-type
PfamPF027011.0E-291666IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-231766IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MQDIHSIGGG GAGRGRCDSS NTKFCYYNNY NLSQPRHFCK GCRRYWTKGG VLRNVPVGGG  60
CRKNKRSKKL TNDSSASSNI STTAPRDQPK KSDPNDHSSS ESSSLSASAA VEAVHSSTSA  120
SDLNKGTKNH DVLNRIGESK LFDGFETAAD CGIFQEIGSF TSLIGSSADT LPFEFAGTTP  180
VEQGMGLIDQ TAMGNSRSRS GGGFGALDWE ETGDGSGSAA LFDLPSAVDQ AYWSQSQWTT  240
NGQDPSAGLY LP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281321e-44AB028132.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-8.
GenBankAK0610001e-44AK061000.1 Oryza sativa Japonica Group cDNA clone:006-203-F09, full insert sequence.
GenBankAK1008921e-44AK100892.1 Oryza sativa Japonica Group cDNA clone:J023130J11, full insert sequence.
GenBankAK1013211e-44AK101321.1 Oryza sativa Japonica Group cDNA clone:J033034E07, full insert sequence.
GenBankAP0052841e-44AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAP0149581e-44AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-44CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankGQ1835321e-44GQ183532.1 Oryza sativa Japonica Group Dof-type zinc finger protein 05 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322044.27e-60hypothetical protein POPTR_0015s03520g, partial
SwissprotQ8LDR09e-50DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA9PI217e-60A9PI21_POPTR; Putative uncharacterized protein
TrEMBLB9IE187e-60B9IE18_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0015s03520.12e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-44OBF binding protein 4